SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020003 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020003
Domain Number 1 Region: 315-397
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.21e-19
Family PCI domain (PINT motif) 0.017
Further Details:      
 
Domain Number 2 Region: 108-332
Classification Level Classification E-value
Superfamily TPR-like 0.00000113
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020003   Gene: ENSPANG00000023029   Transcript: ENSPANT00000020952
Sequence length 422
Comment pep:known_by_projection chromosome:PapAnu2.0:16:25599276:25636075:1 gene:ENSPANG00000023029 transcript:ENSPANT00000020952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKAD
VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK
LT
Download sequence
Identical sequences A0A096P3S8 A0A0D9R227 A0A0P6J991 A0A1A6GUW9 A0A1S3F7G0 A0A1U7T4L1 A0A250Y0Q4 A0A287D023 A0A2K5CF69 A0A2K5NXK2 A0A2K5RCB0 A0A2K6BZY3 A0A2K6FW56 A0A2K6KVQ7 A0A2K6PH42 A0A2K6TTK2 D2GU64 E2RJ26 F1LMZ8 F7IT21 G1R265 G1SVA3 G3QFG6 G7NGU5 H0VFF3 H2NTA7 H2QCM9 L5JU32 O00231 Q2KI42 Q4R330
5gjq_Q 5gjr_4 5gjr_Q 5l4k_Q 5ln3_Q 5m32_l 5t0c_AX 5t0c_BX 5t0g_X 5t0h_X 5t0i_X 5t0j_X 6epc_Q 6epd_Q 6epe_Q 6epf_Q ENSOCUP00000007344 10141.ENSCPOP00000008795 9598.ENSPTRP00000015341 9600.ENSPPYP00000009176 9606.ENSP00000261712 9986.ENSOCUP00000007344 ENSPANP00000020003 ENSMICP00000010790 ENSP00000261712 ENSP00000393185 ENSCAFP00000027158 ENSNLEP00000007287 NP_001039613.1.59421 NP_001039613.1.76553 NP_001257411.1.87134 NP_001257411.1.92137 NP_001274254.1.63531 NP_002806.2.87134 NP_002806.2.92137 XP_002748424.2.60252 XP_002827282.2.23681 XP_003279425.1.23891 XP_003469534.2.53824 XP_003818065.1.60992 XP_003933069.1.74449 XP_004042011.1.27298 XP_004267231.1.21590 XP_004441945.1.5094 XP_004593933.1.84141 XP_004608625.1.94378 XP_004664636.1.11716 XP_004684948.1.23501 XP_004747137.2.14098 XP_004870659.1.39548 XP_005327837.1.77405 XP_006744529.1.47382 XP_006890982.1.29581 XP_006925030.1.64745 XP_007106639.1.24612 XP_007190221.1.59432 XP_007452429.1.90284 XP_007935521.1.48129 XP_008009184.1.81039 XP_008047867.1.4292 XP_008047868.1.4292 XP_008269289.1.1745 XP_010370569.1.97406 XP_011229499.1.58354 XP_011358340.1.92234 XP_011745704.1.29376 XP_011793044.1.43180 XP_011923197.1.92194 XP_011970025.1.54773 XP_012304678.1.9421 XP_012503771.1.63892 XP_012591563.1.48125 XP_012784906.1.84141 XP_012871979.1.60039 XP_014717669.1.49734 XP_014953992.1.66739 XP_014974530.1.72884 XP_016008027.1.101085 XP_017397682.1.71028 XP_017746374.1.44346 XP_017746375.1.44346 XP_017919732.1.57651 XP_018883024.1.27298 XP_019279450.1.44245 XP_019279451.1.44245 XP_019502661.1.44202 XP_020017089.1.5219 XP_020136775.1.48125 XP_020754362.1.74333 XP_020754365.1.74333 XP_021486626.1.76796 XP_021560200.1.83697 XP_511403.2.37143 XP_537730.2.84170 ENSNLEP00000007287 ENSPTRP00000015341 ENSPPYP00000009176 ENSCJAP00000026675 ENSCJAP00000026694 gi|28872725|ref|NP_002806.2| ENSTTRP00000010619 ENSCPOP00000008795 ENSBTAP00000025152 ENSMICP00000010790 ENSBTAP00000025152 ENSTTRP00000010619 ENSCAFP00000027158 ENSPPYP00000009176 ENSP00000261712 ENSCPOP00000008795 ENSP00000261712 ENSP00000393185 ENSSTOP00000008694 ENSPTRP00000015341 GO.36579 ENSCJAP00000026675 ENSGGOP00000001037 ENSSTOP00000008694 ENSOCUP00000007344 ENSGGOP00000001037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]