SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020025 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020025
Domain Number 1 Region: 434-678
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 2.25e-48
Family ATP-dependent DNA ligase catalytic domain 0.00026
Further Details:      
 
Domain Number 2 Region: 688-831
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.08e-36
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00019
Further Details:      
 
Domain Number 3 Region: 89-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.17e-30
Family PARP-type zinc finger 0.00000105
Further Details:      
 
Domain Number 4 Region: 925-1007
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000155
Family DNA ligase 0.000016
Further Details:      
 
Domain Number 5 Region: 255-497
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.00000000327
Family ATP-dependent DNA ligase DNA-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020025   Gene: ENSPANG00000022999   Transcript: ENSPANT00000020490
Sequence length 1009
Comment pep:known_by_projection chromosome:PapAnu2.0:16:28099152:28119480:1 gene:ENSPANG00000022999 transcript:ENSPANT00000020490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAFKIPFPQTLRALSRKELYLFREHHRPDVRQFSQWSETDLLHGHPVFLRRKPVLSFQ
GSHLRSRATCLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGICRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAASTPKKKAVVQAKLTTTGQVTSPVKSTSFVTNNNSRKFSGFSAKPNNSGEAP
SSPTPKRSLSSSKCDPKHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVVKTIYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSRLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTP
VQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKASDLADMITRVIREGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKGGNMLTVKPS
AVKVGEKQAMKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFV
AFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC
Download sequence
Identical sequences A0A096P3V0
ENSPANP00000020025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]