SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020032 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020032
Domain Number 1 Region: 10-116
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000129
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 311-356
Classification Level Classification E-value
Superfamily RING/U-box 0.000000294
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 248-285
Classification Level Classification E-value
Superfamily SAP domain 0.0000549
Family SAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020032   Gene: ENSPANG00000023003   Transcript: ENSPANT00000020905
Sequence length 363
Comment pep:known_by_projection chromosome:PapAnu2.0:16:28126630:28141388:-1 gene:ENSPANG00000023003 transcript:ENSPANT00000020905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFARTNQQ
QTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLSLHDIST
EMCREKEELVLLVLGQQPIISQEGRTHASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSS
SAQATSVPPAQVQENQQANGHVSQDQEEPVYLESVARAPAEDETQSIDSEDSFVPGRRAS
LSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVSGAE
DQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHV
FRS
Download sequence
Identical sequences ENSPANP00000020032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]