SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020038 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020038
Domain Number 1 Region: 138-312,370-899
Classification Level Classification E-value
Superfamily ARM repeat 5.21e-30
Family Plakophilin 1 helical region 0.066
Further Details:      
 
Domain Number 2 Region: 6-121
Classification Level Classification E-value
Superfamily TPR-like 5.36e-24
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020038   Gene: ENSPANG00000022993   Transcript: ENSPANT00000020589
Sequence length 929
Comment pep:known_by_projection chromosome:PapAnu2.0:16:28262637:28301996:1 gene:ENSPANG00000022993 transcript:ENSPANT00000020589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVEAVQLKEEGNRHFQLQDYKAATKSYSQALKLTKDKALLATLYRNRAACGLKTESYV
QAASDASRAIDINSSDIKALYRRCQALEHLGKLDQAFKDVQRCATLEPRNQNFQETLRRL
NTSIQEKLRVQFSTDLRVQKMFEILLDENSEADKREKAANNLIVLGREEAGAEKIFQNNG
VALLLQLLDTKKPELVLAAVRTLSGMCSGHQARATVILHAVRIDRICSLMAVENEEMSLA
VCNLLQAIIDSLSGEDKREHRGKEEALVLDTKKDLKQITSHLLDMLVSKKVSGQGRDQAL
NLLNKNVPRKDLAIHDNSRTIYVVDNGLRKILKVVGQVPDLPSCLPLTDNTCMLASILIN
KLYDDLRCDPERDHFRKICEEYITGKFDPQDMDKNLNAIQTVSGILQGPFDLGNQLLGLK
GVMEMMVALCGSERETDQLVAVEALIHASTKLSRATFIITNGVSLLKQIYKTTKNEKIKI
RTLVGLCKLGSAGGTDYGLRQFAEGSTEKLAKQCRKWLCNTSIDTRTRRWAVEGLAYLTL
DADVKDDFVQDIPALQAMFELAKTSDKTILYSVATTLVNCTNSYDVKEVIPELVQLAKFS
KQHVPEEHPKDKKDFIDLRVKRLLKAGVISALACMVKADSAILTDQTKELLARVFLALCD
NPKDRGTIVAQGGGKALIPLALEGTDVGKVKAAHALAKIAAVSNPDIAFPGERVYEVVRP
LVSLLDTQRDGLQNYEALLGLTNLSGRSDKLRQKIFKERALPDIENYMFENHDQLRQAAT
ECMCNMVLHKEVQERFLADGNDRLKLVVLLCGEDDDKVQNAAAGALAMLTAAHKKLCLKM
TQVTTQWLEILQRLCLHDQLSVQHRGLVIAYNLLAADAELAKKLVESELLEILTVVGKQE
PDEKKAEVVQTARECLIKCMDYGFIKPVS
Download sequence
Identical sequences ENSPANP00000020038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]