SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020081 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020081
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 1.66e-47
Family C-type lysozyme 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020081   Gene: ENSPANG00000022921   Transcript: ENSPANT00000020329
Sequence length 194
Comment pep:novel chromosome:PapAnu2.0:9:30062796:30082309:-1 gene:ENSPANG00000022921 transcript:ENSPANT00000020329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDAHLSCQSPTKWNSVSSADSPEKSASGAGTGNLPFQFCLQQALRMKAAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQRVLDDGSIDYGI
FQINSFTWCRHGKLQENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCE
GRDLSDWKKGCEVS
Download sequence
Identical sequences A0A096P406
ENSPANP00000020081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]