SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020121 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020121
Domain Number 1 Region: 139-381
Classification Level Classification E-value
Superfamily vWA-like 2e-84
Family Integrin A (or I) domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 639-727
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.88e-22
Family Integrin beta tail domain 0.0012
Further Details:      
 
Domain Number 3 Region: 354-469
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-22
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 4 Region: 25-84
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000167
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 596-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Integrin beta EGF-like domains 0.0037
Further Details:      
 
Domain Number 6 Region: 555-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020121
Domain Number - Region: 521-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0268
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020121   Gene: ENSPANG00000022879   Transcript: ENSPANT00000020077
Sequence length 799
Comment pep:known_by_projection chromosome:PapAnu2.0:9:32326929:32360995:-1 gene:ENSPANG00000022879 transcript:ENSPANT00000020077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQLIFWIGLISSICCVFGQTTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMP
TSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQL
VLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSD
FRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQ
RISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDG
QCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGT
LSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNIS
IGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHE
GNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCR
KRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTC
EASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKD
TCAQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVE
NPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGE
NPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences ENSPANP00000020121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]