SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020134 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020134
Domain Number 1 Region: 274-425
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.17e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000546
Further Details:      
 
Domain Number 2 Region: 428-585
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.77e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000556
Further Details:      
 
Domain Number 3 Region: 645-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-38
Family MAM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 26-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-33
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 5 Region: 146-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020134   Gene: ENSPANG00000022837   Transcript: ENSPANT00000019888
Sequence length 924
Comment pep:known_by_projection chromosome:PapAnu2.0:9:32608675:32763393:-1 gene:ENSPANG00000022837 transcript:ENSPANT00000019888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKGLPLLCAALALALAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQA
PDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGRLWGKFCGKIAPPPVVSSGQFLF
IKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAP
KMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSS
GILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEAVGMESGEIHSDQITASSQYSTN
WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKI
DVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFE
VYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSY
VNEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSF
EGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNPV
DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTF
CHWEHDNHVQLKWSVLTSKTGPIQDHTAGDGNFIYSQADENQKGKVARLVSPVVYSQNSA
HCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQV
IFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEG
DKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENY
NFELVDGVKLKKDKLNTQSTYSEA
Download sequence
Identical sequences ENSPANP00000020134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]