SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020200 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020200
Domain Number 1 Region: 146-269
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.14e-29
Family Synaptotagmin-like (S variant) 0.0014
Further Details:      
 
Domain Number 2 Region: 269-407
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.91e-26
Family Synaptotagmin-like (S variant) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020200   Gene: ENSPANG00000022638   Transcript: ENSPANT00000019187
Sequence length 421
Comment pep:novel chromosome:PapAnu2.0:9:42598227:42606907:-1 gene:ENSPANG00000022638 transcript:ENSPANT00000019187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQLALVIGGTIGGLLLLLLIGASCCLWRRFCATLTYEELPGTPAMDSAAASSGQQDRP
CQPHARTQLSRPPDVPFVVPPSLQGRDWVPLHSGEWTHAPWDSCPASELLPHTPSGGLGD
ACMVGAINPELYKFPEDKSETDFPAGCLGRLWFSVEYEQEAERLLVGLIKARHLQAPSET
CSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTVTQRVLKFSVYHVDRQRK
HQLLGQVLFPLKNETLAGDCRRVIWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVL
RAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSINPVYNETFSFKADATELDT
ASLSLTVVQNTEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRWHALCRITE
P
Download sequence
Identical sequences A0A096P4C5
ENSPANP00000020200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]