SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020228 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020228
Domain Number 1 Region: 298-405
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-26
Family SH2 domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020228   Gene: ENSPANG00000022612   Transcript: ENSPANT00000018903
Sequence length 435
Comment pep:known_by_projection chromosome:PapAnu2.0:9:49459093:49531142:-1 gene:ENSPANG00000022612 transcript:ENSPANT00000018903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRLGLNWLQAILLPLPPKMLGLQARTTMPDLHASLYTCVSVENLGNGVSSIVFLASRT
TVPIYTPMLETAYFSPSLPTLDSDRPRKNCSLFLFQVLLSCGPSVFHTSLYLWCSLGRRQ
KEAEITKKFRDALANEKARILAEKWKVEMEDRKAAKVLEERIQEEFKRKEEEERKRGEEQ
IRLQEEQRAKELFWTLKQAQLHCQASEKEEREWEEQLRRSKAADEERSRRAQRARDEYRR
QSLRAIQKGTVAGLSSMFRELGQSHEQEARLYHHLPGPGPPQPLALPVSRTWERPLRPVS
RDVIVRWFKEEQLPRRAGFERNTKFIAPWFHGIISREDAEDLLENMTEGAFLVRVSEKIW
GYTLSYRLQKGFKHFLVDASGDFYSFLGVDPNRHATLTDLIDFHKEEIITVSGGELLQEP
CGQRDSPPDYHPLFE
Download sequence
Identical sequences ENSPANP00000020228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]