SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020273 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020273
Domain Number 1 Region: 37-204
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-43
Family Dual specificity phosphatase-like 0.0000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020273   Gene: ENSPANG00000022463   Transcript: ENSPANT00000018601
Sequence length 219
Comment pep:known_by_projection chromosome:PapAnu2.0:9:54653555:54690758:1 gene:ENSPANG00000022463 transcript:ENSPANT00000018601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGEVKTSLKNAYSSAQRLSPKVEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFD
LSVFFHPAAAFIDRALRDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKN
RCVLPNRGFLKQLRELDKQLVQQRRQAQCQDSEGDGREL
Download sequence
Identical sequences A0A096P4J8
ENSPANP00000020273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]