SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020274 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020274
Domain Number 1 Region: 708-976
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.07e-109
Family N-acetyl transferase, NAT 0.000000000969
Further Details:      
 
Domain Number 2 Region: 254-316
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000244
Family PHD domain 0.005
Further Details:      
 
Domain Number 3 Region: 101-180
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000816
Family Linker histone H1/H5 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020274   Gene: ENSPANG00000022464   Transcript: ENSPANT00000018602
Sequence length 2005
Comment pep:known_by_projection chromosome:PapAnu2.0:9:54697534:54885547:-1 gene:ENSPANG00000022464 transcript:ENSPANT00000018602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPECIECKTCSACRVQGRNADNMLFCDSCDRGFHMECCDPPLSRMPKGM
WICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDEGSMNAFTGRGS
PGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYISASTLKVNKKT
KGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLATGTTQKLKPPP
SSLPPPTPISGQSPSSQKSSTATSSPSPQSSSSQCSVPSLSGLTTNSQLKALFDGLSHIY
TTQGQSRKKGHPSYAPPKRMRRKTELSSTAKSKAHFFGKRDIRSRFISHSSSSSWGMARG
RIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKPDQDDDTEIKIN
IKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYPSVIEFGKYEIQ
TWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFE
VDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYFSKEKLCQQ
KYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYLAYWKSVIL
EYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRREKLILSHMEKL
KTCSRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEKEEQEVLSTRAN
SRQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEENIQSSPPRLTKPQSVAIKRK
RPFVLKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDG
RKPVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKC
KQAWPKGTKRGLSKWRQNKERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPTP
ISIEEEAKEAGEALLPQEENRRQETCAPVSPNTSPGEKPEDDLIKGGGNVEKDPDGAKSQ
EKEEPEISTEKEDSARLDDHEEEEEEDEEPSHNEDHDADDEDDSHMESAEVEKEELPRES
FKEVLENQEAFLDLNVQPSHSNPEVLMDCGVDLTASCNSEPKELAGDPEAVPESDEEPPP
GEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSLTQESSEQDDTFQDCAETQEA
CRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVPALENSYAQ
ISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDS
TMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSISSPPTCSV
KSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETGNANIGLYERMGQSDFGAGHY
PQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSV
PGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTK
SASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNT
LNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHSNMMY
TAPGHHGYMNTGMSKQSLNGSYMRR
Download sequence
Identical sequences ENSPANP00000020274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]