SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020278 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020278
Domain Number 1 Region: 957-1129
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.4e-63
Family alpha-catenin/vinculin 0.0000000736
Further Details:      
 
Domain Number 2 Region: 39-249
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.06e-62
Family alpha-catenin/vinculin 0.00000125
Further Details:      
 
Domain Number 3 Region: 272-424
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.42e-50
Family alpha-catenin/vinculin 0.0000047
Further Details:      
 
Domain Number 4 Region: 490-646
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.02e-49
Family alpha-catenin/vinculin 0.0000000946
Further Details:      
 
Domain Number 5 Region: 720-854
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.35e-45
Family alpha-catenin/vinculin 0.000000429
Further Details:      
 
Domain Number 6 Region: 649-718
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.94e-20
Family alpha-catenin/vinculin 0.0000216
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020278
Domain Number - Region: 882-916
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0002
Family alpha-catenin/vinculin 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020278   Gene: ENSPANG00000022469   Transcript: ENSPANT00000018597
Sequence length 1134
Comment pep:known_by_projection chromosome:PapAnu2.0:9:55610232:55738652:-1 gene:ENSPANG00000022469 transcript:ENSPANT00000018597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKDWLHDPSAFPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGL
DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRA
VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD
LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEG
IQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQ
PVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAK
DIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNIS
DEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
Download sequence
Identical sequences A0A096P4K3 A0A2K5KUA8 A0A2K6CC43 F7HSL6
XP_011713035.1.29376 XP_011940941.1.92194 XP_015002756.1.72884 ENSPANP00000020278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]