SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020302 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020302
Domain Number 1 Region: 249-407,747-842
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.75e-73
Family beta-sandwich domain of Sec23/24 0.002
Further Details:      
 
Domain Number 2 Region: 499-744
Classification Level Classification E-value
Superfamily vWA-like 4.34e-71
Family Trunk domain of Sec23/24 0.0000777
Further Details:      
 
Domain Number 3 Region: 949-1090
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.22e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.00064
Further Details:      
 
Domain Number 4 Region: 844-948
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 9.42e-31
Family Helical domain of Sec23/24 0.0069
Further Details:      
 
Domain Number 5 Region: 410-495
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.44e-25
Family Zn-finger domain of Sec23/24 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020302   Gene: ENSPANG00000022453   Transcript: ENSPANT00000018319
Sequence length 1094
Comment pep:known_by_projection chromosome:PapAnu2.0:9:55975342:55999232:-1 gene:ENSPANG00000022453 transcript:ENSPANT00000018319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVNQSVPPVPSFGQPQPVYPGYHQSSYGGQSGSTAPTIPYGAYNGPVPGYQQTPPQGMS
RAPPSSGAPPASTAQAPCGQAAYGQFGQGDVQNGPSSTVQMQRLPGSQPFGSPLAPVGNQ
PAVLQPYGPPPTSAQVTAQLSGMQISGAVAPAPPSSGLGYGPPTSLASASGSFPNSGLYG
SYPQGQAPPLSQAQGHPGIQTPQRSAPSQASGFTPPASGGPRLPSMTGPLLPGQSFGGPS
VSQPNHVSSPPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQPNYGSP
YPAAPTFGSQSGPQPLPPKRLDPDAIPSPIQVIEDDRNNRGTEPFVTGVRGQVPPLVTTN
FLVKDQGNASPRYIRCTSYNIPCTSDMAKQAQVPLAAVIKPLARLPPEEASPYVVDHGES
GPLRCNRCKAYMCPFMQFIEGGRRFQCCFCSCINDVPPQYFQHLDHTGKRVDAYDRPELS
LGSYEFLATVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGA
EESAIRVGFVTYNKVLHFYNVKSSLAQPQMMVVSDVADMFVPLLDGFLVNVNESRAVITS
LLDQIPEMFADTRETETVFVPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNRDD
RKLINTDKEKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSV
YKYACFQVENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVEL
AGLDGDKTVTVEFKHDDRLNEESGALLQCALLYTSCAGQRRLRIHNLALNCCTQLADLYR
NCETDTLINYMAKFAYRGVLNSPVKAVRDTLITQCAQILACYRKNCASPSSAGQLILPEC
MKLLPVYLNCVLKSDVLQPGAEITTDDRAYVRQLVTSMDVAETNVFFYPRLLPLTKSPIE
STTEPPAVRASEERLSNGDMYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSV
LPVLDNPLSKKVRGLIDSLRAQRSRYMKLIVVKQEDKLEMLFKHFLVEDKSLSGGASYVD
FLCHMHKEIRQLLS
Download sequence
Identical sequences A0A096P4M7 A0A2K5MY92
XP_011940890.1.92194 ENSPANP00000020302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]