SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020312 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020312
Domain Number 1 Region: 305-422,592-767
Classification Level Classification E-value
Superfamily TPR-like 5.5e-24
Family Tetratricopeptide repeat (TPR) 0.006
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020312
Domain Number - Region: 235-289
Classification Level Classification E-value
Superfamily CytB endotoxin-like 0.0837
Family CytB endotoxin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020312   Gene: ENSPANG00000022383   Transcript: ENSPANT00000001206
Sequence length 777
Comment pep:known_by_projection chromosome:PapAnu2.0:9:56328290:56417000:1 gene:ENSPANG00000022383 transcript:ENSPANT00000001206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLLYPGVKRIRGAFHVYPYLDSVVHEKTKCLLSLFRDIGHHLIHNNKIGGINSLLSKQ
AVSKNLKEDKPVKEKDIDGRPRPGDVQAPSIKSQSSDTPLEGEPPLSHNPEGQQYVEAGT
YIVLEIQLDKALVPKRMPEELARRVKEMIPPRPPLTRRTGGAQKAVSDYHTQIKNISRAI
LDEYYRMFGKQVAKLESDMDSETLEEQKCQLSYELNCSGKYFAFKEQLKHAVVKIVREKY
LKTTSFESQEELQTFISELYVFLVDQMHVALNQTMPDDVQGTIATIFTSSEQLRLFAFEA
EVNENFEMAAAYYKERLVREPQNLDHWLDYGAFCLLTEDNIKAQECFRKALSLNQSHIHS
LLLCGVLAVLLENYEQAEIFFEDATCLEPTNVVAWTLLGLYYEIQNNDIRMEMAFHEASK
QLQAQMLQAQVTKQKSAGVVEDIEERGKRESSLGPWGITNGSATAIKVEAPAGPGAALSI
LDKFLEESSKLQSDSQEPILTTQTWDPSINQKPSNTFIKEIPTKKEASKCQDSSAFLHPG
LHYGVSQTTTIFMETIRFLMKVKAVQYVHRVLAHELLCPQGGPSCEYYLVLAQTHILKKD
FAKAEEYLQQAAQMDYLNPNVWGLKGHLYFLSGNHSEAKACYERTISFVVDASEMHFIFL
RLGLIYLEEKEYEQAKKIYMQACKRSPSCLTWLGLGIACYRLEELTEAEDALSEANALNN
YNAEVWAYLALVCLKVGRQLEAEQAYKYMIKLKLKDEALLAEIHTLQETVGFGNPSF
Download sequence
Identical sequences ENSPANP00000020312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]