SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020319 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020319
Domain Number 1 Region: 19-94
Classification Level Classification E-value
Superfamily PDZ domain-like 1.73e-18
Family PDZ domain 0.0000749
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020319
Domain Number - Region: 208-264
Classification Level Classification E-value
Superfamily EF-hand 0.000124
Family Calmodulin-like 0.025
Further Details:      
 
Domain Number - Region: 276-316
Classification Level Classification E-value
Superfamily BAG domain 0.0361
Family BAG domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020319   Gene: ENSPANG00000022358   Transcript: ENSPANT00000000567
Sequence length 494
Comment pep:known_by_projection chromosome:PapAnu2.0:16:36091097:36265100:1 gene:ENSPANG00000022358 transcript:ENSPANT00000000567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKNTSTVVPSSLLEKDPAFQVITITKETGLGLKILGGINRNEGPLVYIQEIIPGGDCYK
DGRLKPGDQLVSVNKESMIGVSFEEAKSIITRAKLRSESAWEIAFIRQKSNNIQPENLSC
TSLVEASGEYGPQASTFSPPEILIPKTSSTPKTNNAILPSCEVNKTGYNKTEQIPITSSE
NSSVGLSNTDVASAWTENYGLQEKISLNPSVRFKAEKLEMALNYLGIQPTKEQHQALRQQ
VQADSKGTVSFGDFVQVARNLFCLRLDDVNVGAHEISKILDSQLLPCDSLEADEMERLKR
ERDDAFKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALRSRIHLAEAAQRQ
AHGMEMDYEEVIRLLEAKITELKAQLADYSDQNKESVQDLKKRIMVLDCQLRKSEMARKT
FEASTEKLLHFIEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGRNIPATLALES
KELVKSVRALLDMD
Download sequence
Identical sequences ENSPANP00000020319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]