SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020327 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020327
Domain Number 1 Region: 163-250
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000987
Family Tetratricopeptide repeat (TPR) 0.00000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020327   Gene: ENSPANG00000022355   Transcript: ENSPANT00000001199
Sequence length 534
Comment pep:known_by_projection chromosome:PapAnu2.0:9:56593496:56666790:1 gene:ENSPANG00000022355 transcript:ENSPANT00000001199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWA
EKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQY
FPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADY
YHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALVLTKKLLELDPEHQR
ANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKM
TPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRL
RRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANY
GVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKG
TAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE
Download sequence
Identical sequences A0A096P4Q2 A0A2K5LEF5 G7N269 G7PF19
ENSPANP00000020327 XP_005565592.1.63531 XP_011940802.1.92194 XP_015002886.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]