SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020331 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020331
Domain Number 1 Region: 179-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000647
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 220-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000184
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020331
Domain Number - Region: 144-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000537
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 64-122
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 0.0706
Family Creatinase/aminopeptidase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020331   Gene: ENSPANG00000022326   Transcript: ENSPANT00000002066
Sequence length 545
Comment pep:known_by_projection chromosome:PapAnu2.0:9:56749502:56783448:-1 gene:ENSPANG00000022326 transcript:ENSPANT00000002066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVDGEWY
RFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDEDCHGSCSDTSECTCAPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDIEGCHNNNGGCSHSCLG
SEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVSIPRELVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPC
LYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPLVHVSGLESLVESCFATPTSKIDEVLKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQSQTLTGGPIR
IDWED
Download sequence
Identical sequences A0A096P4Q6 A0A2K5NNV4 A0A2K5V505 G7N271
ENSPANP00000020331 XP_005565598.1.63531 XP_011940798.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]