SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020337 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020337
Domain Number 1 Region: 139-248
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.55e-33
Family Chaperone J-domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020337
Domain Number - Region: 34-76
Classification Level Classification E-value
Superfamily TPR-like 0.00449
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020337   Gene: ENSPANG00000022312   Transcript: ENSPANT00000001211
Sequence length 411
Comment pep:novel chromosome:PapAnu2.0:9:57371007:57392667:1 gene:ENSPANG00000022312 transcript:ENSPANT00000001211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLRARLPATRRRVAQPFARPASPSLVPRSGSAMESNKDEAERCISIALKAIQSNQPDR
ALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHATHRKAGGTSAPSANGEA
GGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRKLALKFHPDKNHAPG
ATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNM
FFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLM
VSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLR
NNCWKEKQQKEGLLYRARYFGDTDMYHKAQKMSTPSCSRLSETMKSLENFW
Download sequence
Identical sequences A0A2K6DA58
XP_005565617.1.63531 XP_011713177.1.29376 XP_011846496.1.47321 XP_011940785.1.92194 XP_015002901.1.72884 ENSPANP00000020337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]