SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020442 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020442
Domain Number 1 Region: 639-677
Classification Level Classification E-value
Superfamily SAP domain 0.000000256
Family SAP domain 0.0024
Further Details:      
 
Domain Number 2 Region: 904-949
Classification Level Classification E-value
Superfamily EF-hand 0.0000269
Family Calmodulin-like 0.064
Further Details:      
 
Domain Number 3 Region: 146-207
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000445
Family Cold shock DNA-binding domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020442   Gene: ENSPANG00000022123   Transcript: ENSPANT00000002758
Sequence length 1131
Comment pep:known_by_projection chromosome:PapAnu2.0:9:61076064:61154971:-1 gene:ENSPANG00000022123 transcript:ENSPANT00000002758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPAN
YQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLS
TPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTP
QVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQT
QPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAFKAGLLQPPVRIVSQPQPARRLDP
PSRFSGRNDRGDQVPNRKDDRSIRNISNFRKICFQSSPQRKRSRERSPRRERERSPRRVR
RVVPRYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNY
CNFYVMHREVESLEKNMAILDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRD
GFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDL
SVCTQWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQ
LVEKLQGERKEADGEQDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRALSSK
GLKSQLIARLTKQLKVEEQKEEQKELEKSEKEEDEEDDRKSEDDKEEEERKRQEEMERQR
RERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVVSLFAELFN
EMLQRDFGVRIYKSLLSLPEKEADEPKPKRRKSGDDKDKKEDRDERKVDVDFHQNIRCKS
QTERFYNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDINRYCKERPSKDKEKEKTQMI
TVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVVLRESCFYRKL
TDTSKDEENHEESESLQEDMLGNRLLLPTPTVKQESKDVEENVGLIVYNGAMVDVGSLLQ
KLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLTQLQENLKI
SENMNLQFENQLNKTIRNLSTVMDEIHTVLKKDNVKNEDKDQKSKENGASV
Download sequence
Identical sequences ENSPANP00000020442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]