SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020450 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020450
Domain Number 1 Region: 403-456
Classification Level Classification E-value
Superfamily EF-hand 0.00000000832
Family Eps15 homology domain (EH domain) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020450   Gene: ENSPANG00000022120   Transcript: ENSPANT00000002615
Sequence length 1401
Comment pep:known_by_projection chromosome:PapAnu2.0:16:44177731:44260844:-1 gene:ENSPANG00000022120 transcript:ENSPANT00000002615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIMMYFYSVFSFMFPVAGGIRPPQAGLMPMQQQGFPMVSVMQPNMQGIMGMNYSSQMSQ
GPIAMQAGIPMGPMPAAGMPYLGQAPFLGMRPPGPQYTPDMQKQFAEEQQKRFEQQQKLL
EEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGFSRDAKMHPTPASHPK
KPDCPTSSHSTKTVSPSPAFLDEEEFSDFMQGPVEVPPCGPSSPSQPFQSFHPSTPLVQL
HTQKAGTQPLPPGQSPVPFALHGVPGQIPYFSTASASHSVPKAGPSLEEKFLVSCDISTS
GQEQIKLNTSEVGHKALGPGSSKSHPSVTASNGGAVDGCVSGTTTAEAEKTSDQNLSIEE
SGVGVFPSQDPAQPRMPPWIYNESLVPDAYKKILETTMTPTGIDTAKLYPILMSSGLPRE
TLGQIWALANRTTPGKLTKEELYTVLAMIAVTQRGVPAMSPDALNQFPAAPIPTLSGFSV
TLPAPVSQPTVIPTGPAGSMPLSLGQPVMGINLVGPVSGAAAQASSGFIPTFPANQVVKP
EEDDFQDFQDASKSGSLDDSFSDFQELPASSKASNSQHGNSAPSLLMPLPGTKALPSMDK
YAVFKGIAADKSSENTVPPGDPGDKYSAFRELEQTAENKPLGESFAEFRSAGTDDGFTDF
KTADSVSPLEPPTKDKTFPPSFPSGTIQQKQQTQVKNPLNLADLDMFSSVNCSSEKPLSF
SAAFSTSKSVSTPQSTGSAAATTALASTKTSSLADEFGEFNLFGEYSGLPPVGEQDDFAD
FMAFSNSSISSEQKPDDKYDALKEEASPVPLTSNMGSTVKGGQNLTAVSTKYDVFRQLSL
EGSGLGVEDLKDNTPSGRSDDDFADFHSSKFSSINSDKSLGEKAVAFRHTKEDSASVKSL
DLPSIGGSSVGKEDSEDALSVQFDMKLADVGGDLKHVMSDSSLDLPTVSGQHPPAADIED
LKYAAFGSYSSNFAVSTLTSCDWSDRDDATQGRKLSPFVLSAGSGSPSATSILQKKETSF
GSSENITMTSLSKVTTFASEDALPETTFPAFASFKDMIPQTSEQKEYESRDYKDFTRQDL
PTAERSPEATCPSPASSGASQETPNECSDDFGEFQSEKPKISKFDFLVATSQSKMKSSEE
MIKSELATFDLSVQGSHKRSLSLGDKEISRSSPSPALEQPFRDRSNTLNEKPALPVIRDK
YKDLTGEVEENERYAYEWQRCLGSALNVIKKANDTLNGISSSSVCTEVIQSAQGMEYLLG
VVEVYRVTKRVELGIKATAVCSEKLQQLLKDIDKVWNNLIGFMSLATLTPDENSLDFSSC
MLRPGIKNAQELACGVCLLNVDSKSRKEEKPAEEHPKKAFNSETDSFKLAYGGHQYHASC
ANFWINCVEPKPPGLVLPDLL
Download sequence
Identical sequences ENSPANP00000020450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]