SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020507 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020507
Domain Number 1 Region: 48-261,378-415
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.27e-61
Family Inositol polyphosphate kinase (IPK) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020507   Gene: ENSPANG00000021997   Transcript: ENSPANT00000004065
Sequence length 416
Comment pep:known_by_projection chromosome:PapAnu2.0:9:71690818:71763295:1 gene:ENSPANG00000021997 transcript:ENSPANT00000004065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEPPSPLRVEAPGPPEMRTPPAIEATPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGK
DKVGILQHPDGTVLKQLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPP
TAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLG
MRVYHVHSDSYETQNQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKILQWF
ENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSKGQLSDTEVLEYNNNFHVLSS
TANGKIEASVGKSLSKMYARHRKMYTKKHHSQTSLKVEHLEQDNGWKSMSQEHLNGNVLS
QLEKVFYHLPTGCQEIAEVEVRMIDFAHVFPSNTIDEGYVYGLKHLISVLRSILDN
Download sequence
Identical sequences A0A096P582 A0A1D5RGR9 A0A2K5L7C2 A0A2K5TQ13
ENSPANP00000020507 XP_005565879.1.63531 XP_011906159.1.92194 XP_015003078.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]