SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020540 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020540
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.79e-17
Family FAD-linked reductases, N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020540   Gene: ENSPANG00000021898   Transcript: ENSPANT00000004110
Sequence length 175
Comment pep:known_by_projection chromosome:PapAnu2.0:9:80587024:80680147:-1 gene:ENSPANG00000021898 transcript:ENSPANT00000004110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVLIVGAGVTGSLCAALLRRQTSRPLYLAVWDKAEDSGGRMTTASSPHNPQCTADLGA
QYITCTPHYAKKHQRFYDELLAHGILRPLTSPIEGMVMKAGDCNFVAPQGISSIIKHYLK
ESGAEVYFRHHVTQINLRNDKWEVSKQTGPPEQFDLIVLTMPVPQILQLQGDITN
Download sequence
Identical sequences ENSPANP00000020540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]