SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020555 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020555
Domain Number 1 Region: 23-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-19
Family Selenoprotein W-related 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020555   Gene: ENSPANG00000021740   Transcript: ENSPANT00000004710
Sequence length 115
Comment pep:known_by_projection chromosome:PapAnu2.0:16:46408001:46408961:-1 gene:ENSPANG00000021740 transcript:ENSPANT00000004710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIMVEYCEPCGFEATYLELASAVKEQYPGIEIESRLG
GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASKGEPLEKITNSRPPCVIL
Download sequence
Identical sequences F7D6V1 I7GJY4
ENSMMUP00000001805 9544.ENSMMUP00000001805 NP_001253733.1.72884 NP_001270417.1.63531 ENSPANP00000020555 ENSMMUP00000001805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]