SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020564 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020564
Domain Number 1 Region: 398-461
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000133
Family C-terminal fragment of elongation factor SelB 0.072
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020564
Domain Number - Region: 175-332
Classification Level Classification E-value
Superfamily TPR-like 0.00235
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020564   Gene: ENSPANG00000021749   Transcript: ENSPANT00000005032
Sequence length 534
Comment pep:known_by_projection chromosome:PapAnu2.0:16:46655826:46672779:1 gene:ENSPANG00000021749 transcript:ENSPANT00000005032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQEGSARRRGADKAKPPPGGGEQEPPLPPAPQDVEMKEEASTGGGSTGEADGKTAAAAA
EHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGF
FTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASAPLLPEVEAYLQLLMVIFMMNSKR
YKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATL
RHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQL
EYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPY
FLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLA
DIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRI
SFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
Download sequence
Identical sequences A0A096P5D9
ENSPANP00000020564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]