SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020566 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020566
Domain Number 1 Region: 390-453
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000131
Family C-terminal fragment of elongation factor SelB 0.072
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020566
Domain Number - Region: 167-324
Classification Level Classification E-value
Superfamily TPR-like 0.0019
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020566   Gene: ENSPANG00000021749   Transcript: ENSPANT00000004937
Sequence length 526
Comment pep:known_by_projection chromosome:PapAnu2.0:16:46655826:46672779:1 gene:ENSPANG00000021749 transcript:ENSPANT00000004937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQEGSARRRGADKAKPPPGGGEQQDVEMKEEASTGGGSTGEADGKTAAAAAEHSQRELD
TVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATR
DFLLPFLEEPMDTEADLQFRPRTGKAASAPLLPEVEAYLQLLMVIFMMNSKRYKEAQKIS
DDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQA
TLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRT
MTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVR
TGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQL
DSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHN
MSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
Download sequence
Identical sequences ENSPANP00000020566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]