SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020572 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020572
Domain Number 1 Region: 152-284,317-360
Classification Level Classification E-value
Superfamily TPR-like 2.09e-22
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 2 Region: 51-188
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000109
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number 3 Region: 315-458
Classification Level Classification E-value
Superfamily TPR-like 0.0000256
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020572   Gene: ENSPANG00000021698   Transcript: ENSPANT00000005358
Sequence length 472
Comment pep:known_by_projection chromosome:PapAnu2.0:9:81386972:81392769:1 gene:ENSPANG00000021698 transcript:ENSPANT00000005358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENAKNSLESSLRQLKCHFTWNLMEGENSLDDFEDKVFYRTEFQNREFKATMCNLLAYL
KHLKGQNEEALECLCKAEELIQQEHADQAEIRSLVTWGNYAWVYYHMGRLSDAQIYVDKV
KHICEKFSSPYRIESPELDCEEGWTRLKCGGNQNERAKVCFEKALEKKPKNPEFTSGLAI
ASYRLDNWPPSQNAIDPLRQAIRLNPDNQYLKVLLALKLHKMREEGEEEGEGEKLVQEAL
EKAPGVTDVLRSAAKFYRRKDEPDKAIELLKKALEYLPNNAYLHCQIGCCYRAKVLQVMN
LRENGIYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEEAEYYFQKE
FSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAK
MRLSKNGADSEALHVLALLQELNKKMQQADEDSERGLESGSLIPSASSWNGE
Download sequence
Identical sequences ENSPANP00000020572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]