SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020573 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020573
Domain Number 1 Region: 135-278,415-440
Classification Level Classification E-value
Superfamily TPR-like 4.16e-25
Family Tetratricopeptide repeat (TPR) 0.0095
Further Details:      
 
Domain Number 2 Region: 50-129
Classification Level Classification E-value
Superfamily TPR-like 0.000000303
Family Tetratricopeptide repeat (TPR) 0.067
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020573
Domain Number - Region: 316-440
Classification Level Classification E-value
Superfamily TPR-like 0.0114
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020573   Gene: ENSPANG00000021699   Transcript: ENSPANT00000005359
Sequence length 487
Comment pep:known_by_projection chromosome:PapAnu2.0:9:81412122:81427568:1 gene:ENSPANG00000021699 transcript:ENSPANT00000005359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEVTKNSLEQILPQLKCHFTWNLFKEESVSRDLEDRVCNQIEFLNTEFKATMYNLLAYI
KHLDGKNEAALECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKV
KQTCKKFSNPYSIEYPELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAM
YHLDNNPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGEQLVEEALEKAPCQ
TDVLRSAAKFYRRKGDLDKAIELFQRALESTPNNGYLYHQIGCCYKAKVRQMQNTGESET
SGNKEKIEALKQYAMDYSNKALEKGLNPLDAYSDLAEFLEAECYQTPFSKEDPDAEKQQS
HQHYCNLQKYNGKSEDTALQRGLEGLSISKKSTEKEEIKDQPQNVSENLLPQNAPNYWYH
QGLIHKQNGDLLQAVKCYEKELGRLLRNAPSGIGSFFLSASELEDGSEEMGQDAVSSNPR
ELVSNSE
Download sequence
Identical sequences A0A096P5E8
ENSPANP00000020573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]