SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020575 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020575
Domain Number 1 Region: 207-371
Classification Level Classification E-value
Superfamily TPR-like 1.58e-19
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 2 Region: 54-244
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000171
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 3 Region: 323-470
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000321
Family Tetratricopeptide repeat (TPR) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020575   Gene: ENSPANG00000021700   Transcript: ENSPANT00000005361
Sequence length 478
Comment pep:known_by_projection chromosome:PapAnu2.0:9:81470309:81485296:1 gene:ENSPANG00000021700 transcript:ENSPANT00000005361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTNGDNHQVKDSLEQLRCHFTWELFIEDDEMPDLENRVLDQIEFLDTKYNVGIHNLLAY
VKHLKGQNEAALKSLKEAEDLMQKEHANQASVRSLVTWSNFAWVYYHMGRLAEAQAYLDK
VENICKKPSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKALEGDHENPEFSTG
YAISAYRLDGFKLATKGYRQFSLLPLRQAVSLNPDNGYLKVLLALKLQDNGQEAEGEKYL
EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
QIKEATKGQPRGQNREKIDKMIRLAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE
ETFQKLLCMKPVVEETMQDIHLQYARFQEFQKKSEINAIIHYLKAIKIEQASFIRDKSIN
SLKKLVLKKLQRNALDLESLSLLGFVYKLKGNMNEALEYYERALRLAADFENSVRQGP
Download sequence
Identical sequences A0A2I3LJ33
ENSPANP00000020575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]