SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020577 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020577
Domain Number 1 Region: 45-109,156-374,430-475
Classification Level Classification E-value
Superfamily TPR-like 2.42e-25
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020577   Gene: ENSPANG00000021702   Transcript: ENSPANT00000005268
Sequence length 482
Comment pep:known_by_projection chromosome:PapAnu2.0:9:81485706:81489510:1 gene:ENSPANG00000021702 transcript:ENSPANT00000005268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEIPKDPLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYNLLAYV
KHLKGQNKDALECLEEAEEIIQREHSDKEEVRSLVTWGNYAWVYYHMNQLEEAQKYTGKI
GNVCKKLSSPSNYKLECPEIDCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGY
AITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAEAEGEKYIEE
ILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTPTSSFLHHQMGLCYRAQMIQI
KKATHNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDI
FWKALRLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALKVKDRSPLRTKLTSAL
KKLATKRLCHNALDVQSLSALGFVYKLEGEKRQAAEYYEKAQKIDPENAEFLTALCDLRL
SI
Download sequence
Identical sequences A0A2I3M4Y4
ENSPANP00000020577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]