SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020644 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020644
Domain Number 1 Region: 17-366
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.38e-116
Family Motor proteins 0.00000000000582
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020644
Domain Number - Region: 679-757,804-857
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000144
Family Apolipoprotein A-I 0.033
Further Details:      
 
Domain Number - Region: 426-586
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0628
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020644   Gene: ENSPANG00000021559   Transcript: ENSPANT00000009326
Sequence length 1058
Comment pep:known_by_projection chromosome:PapAnu2.0:9:84565265:84630283:1 gene:ENSPANG00000021559 transcript:ENSPANT00000009326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLLKVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRV
ITALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKN
ILNKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQ
IVELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKE
EYITSALESTEEKLHDAASKLLNTVEETTKDVSDLHSKLDRKKAVDQHNAEAQDIFGKNL
NSLFNNMEALIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVST
RVSQIFNMILKEQSLAAESKTVLQERINVLKTDLLTSLETILSPTVVSILKINSQLKHIF
KTSLTVADKIEDQKKELDGFLSILRNNLHELQENTISSLVESQKQCGNLTEDLKTIKQTH
SQELCQLINLWTERFCALEEKCENIQKPLSSVQEDIQQKSKDIVNKMTFHSQKFCADSDG
LSQELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEHWVSSLN
EREQELQNLLEVVNQCCEASSSDITEKSNGHKAAHERQHNIFLGQMTIDEEKLIAQNLEL
NETIKIGLTKLNCFLEQDLKLDIPTGTTPQRKNYLYPSTLVRTEPREHLLDQLKRKQPEL
LMMLNSSENNKEETIPDVDVEKAVLGQCTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSH
GKDKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL
Download sequence
Identical sequences ENSPANP00000020644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]