SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020660 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020660
Domain Number 1 Region: 483-836
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.68e-113
Family PDEase 0.000000254
Further Details:      
 
Domain Number 2 Region: 55-252
Classification Level Classification E-value
Superfamily GAF domain-like 1.32e-30
Family GAF domain 0.00066
Further Details:      
 
Domain Number 3 Region: 238-291,323-459
Classification Level Classification E-value
Superfamily GAF domain-like 6.67e-30
Family GAF domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020660   Gene: ENSPANG00000021540   Transcript: ENSPANT00000010027
Sequence length 858
Comment pep:known_by_projection chromosome:PapAnu2.0:9:85570839:85623631:1 gene:ENSPANG00000021540 transcript:ENSPANT00000010027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEINQDAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESA
LCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFLCRSRNGIPEVASRLLDVTPT
SNFDDNLVGPDKEVVFPLDIGIVGWAAHTKKTHNVPDVKKNSHFSDFMDKQTGYVTKNLL
ATPIVMGKEVLAVIMAVNKVNASEFSKQDEEVFSKYLNFVSVILKLHHTSYMYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVNFYKIIDYILHGKEEIKVIPTPPADHWTLISGLPTYVAENGFICN
MMNASADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEY
ITETLTQFLGWSLLNTDTYDKMNKLENRKDIAQEMLMNQTKATPEEIKSILKFQEKLNVD
VIDDCEEKQLVAILKEDLPDPRSAELYEFRFSDFPITEHGLIQCGIRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFI
DFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEEGAEKA
AEDSGGGDDKKSKTCLML
Download sequence
Identical sequences A0A096P5N5
ENSPANP00000020660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]