SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020670 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000020670
Domain Number - Region: 150-233,289-343
Classification Level Classification E-value
Superfamily TPR-like 0.000506
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020670   Gene: ENSPANG00000021519   Transcript: ENSPANT00000010371
Sequence length 437
Comment pep:known_by_projection chromosome:PapAnu2.0:16:48459114:48469593:-1 gene:ENSPANG00000021519 transcript:ENSPANT00000010371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVAWGLLWLLLGSARAQYEKYSFRGFPPEDLMPLAAAYGHALEQYEGESWRESARYLE
AALRLHRLLRDSEAFCHANCSGPAPAPKPDPDDGRADEWARELRLFGRVLERAACLRRCK
RTLPAFQVPYPPRQLLRDFQSRLPYQYLHYALFKANRLEKAVAAAYTFLQRNPKHELTAK
YLNYYRGMLDVADESLTDLEAQPYEAVFLRAVKLYNSGDFRSSTEDMERALAEYLAVFAR
CLAGCEGAHEQVDFKDFYPAIADLFAESLQCKVDCEANLTPNVGGYFVDKFVATMYHYLQ
FAYYKLNDVRQAARSAASYMLFDPNDSIMQQNLVYYRFHRARWGLEEEDFQPREEAMLYH
NQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQE
PDAKGDEAEAEPEPELA
Download sequence
Identical sequences A0A096P5P5 A0A2K5UC54 F7H7U6
XP_001093403.2.72884 XP_015293975.1.63531 ENSPANP00000020670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]