SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020672 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020672
Domain Number 1 Region: 153-279
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-39
Family FKBP immunophilin/proline isomerase 0.00031
Further Details:      
 
Domain Number 2 Region: 42-158
Classification Level Classification E-value
Superfamily FKBP-like 1.2e-37
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 3 Region: 260-376
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-36
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 4 Region: 390-487
Classification Level Classification E-value
Superfamily FKBP-like 9.43e-31
Family FKBP immunophilin/proline isomerase 0.00051
Further Details:      
 
Domain Number 5 Region: 495-568
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000242
Family Calbindin D9K 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020672   Gene: ENSPANG00000021520   Transcript: ENSPANT00000010370
Sequence length 582
Comment pep:known_by_projection chromosome:PapAnu2.0:16:48470724:48479700:1 gene:ENSPANG00000021520 transcript:ENSPANT00000010370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYH
YNGTLLDGTSFDTSYSKGGTYDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEK
GYGTVIPPHASLVFHILLIDVHNPKDTVQLETLELPAGCVRRAVAGDFMRYHYNGSLMDG
TLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACIGERRRITIPPHLAYGENGTGDKIPG
SAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEV
ELVSREDGLPTGYLFVWHEDPPANLFEDMDRNKDGEVPPEEFSTFIKAQVSEGKGRLMPG
QDPEKTIGDMFQNQDRNQDGKITVEELKLKSDEDQERVHEEL
Download sequence
Identical sequences ENSPANP00000020672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]