SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020684 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020684
Domain Number 1 Region: 6-94
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-25
Family PDZ domain 0.00029
Further Details:      
 
Domain Number 2 Region: 286-315
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000563
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 253-285
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000156
Family LIM domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020684   Gene: ENSPANG00000021477   Transcript: ENSPANT00000010741
Sequence length 330
Comment pep:known_by_projection chromosome:PapAnu2.0:9:87024708:87078213:-1 gene:ENSPANG00000021477 transcript:ENSPANT00000010741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSN
MTHLEAQNRIKGCTDNMTLTVARSEHKVWSPLVTEEGGKRHPYKMNLASEPQEVLHIGSA
HNRSAMPFTASPASSTTARVITNQYNNPAGLYSSENISNFNNALESKTAASGVEANSRPL
DHAQPPSSLVIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRS
VKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDHHRHPECYVCTDCGTNLKQKGHF
FVEDQIYCEKHARERVTPPEGYEVVTVFPK
Download sequence
Identical sequences A0A096P5Q9 A0A2K5UPI7 A0A2K6CWQ9 F6YRD0
ENSMMUP00000000614 9544.ENSMMUP00000000614 ENSMMUP00000000614 ENSPANP00000020684 XP_001099155.1.72884 XP_005566074.1.63531 XP_011734168.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]