SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020705 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020705
Domain Number 1 Region: 771-788,825-932
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000257
Family PLC-like (P variant) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020705   Gene: ENSPANG00000021446   Transcript: ENSPANT00000011572
Sequence length 1347
Comment pep:novel chromosome:PapAnu2.0:9:87716728:87808956:1 gene:ENSPANG00000021446 transcript:ENSPANT00000011572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLLKVKAADYEDDQEQIKKQKANIFVPSSSPVVNQHKLPKDMMPRILEDEGFYIQRKPEI
YKKTCNKMENRLLQLEEGKCWFGESGEIMSLPTPIKQSWNFRLNVRKEPLNPLLKTIYRK
KAIKYDLGSSFMNKMEGPREIYQLDLNIVGLQFSHHHLFNQEQVLCARLLQLYECFQDRQ
QQNVSQLLYEKLKALTDATELSNENSEINQLTRKSLQDYYWQISNTKQMYDLERGKDFSL
LRSILRTWKQIKSLRQRQGFTSTPIKLQVQSASWRDSTHDKKAWYLDTELRLSCIKEQQL
QKHERKKNERKQDIYQIGDWFRIKMNKCDEQEQIAEMSETEKKNEGKELNGKKQESLSYL
ASDETEIERIKPIALRPQLSFTAELTSLSKCSLDEQKRRARIQKLKYFIKIFYNNKQVSC
TSVSPLQFDFKVMFQQIFNIQLIYWPEVICLENQMKEYTYKRSPVSVQRSHCKNPHTNTI
LSYCCPKEYISSCSLKRMVKKPPGIKTDVPFLLEGNGTEELCLLTSGKLSYCLSWSSDEN
GLPLIPMSQSLRSSYCSMLRNVDARSVPGIPWLINEQKLFEWANEVRIDPNNPEYSDLME
FVMYMRLKGQDIPKYFRLEQLQDEFNFVSEEEMAKSKRFQLLQLRNAGQLDNFLLQQMPL
HDTEIPDLLFQEYESQKEKEVSISDVNSITAQRINSANLLKKVRKLIMKRIVKISKCNLS
DIVTDYEEIVSTSQLTDAVCQFVEPRRKLKPQRKERKKVRAQTISDGDIKILVRIVRAYN
IPTRKTTKFSEVQDSQSNFNMYILRVWAAFSPSYTVSKWSFEKDTVNPFVEVSFQHTVYQ
TNTASGSHPCWNEEIKVDFISPGHDYSFSSLSKIKDNIYINIFDEMITEKHEDHCLKSCS
AHSYIRKNWLGSIVFPFSALLQQSEISGTFQVTIPPVLLGYTWSNTYVFPKEDSNEQNLK
ECTFLNIFATIEPQISYVTCNPTLDKFLDQTEVLQRAQIFKKNCKAMFPNRRIITTVFND
EGIQFLVTRYIKALNPPQQLLDIFLHNSNATFDLIARFVSLIPFMPNTPDENDGSDIWMT
SERCISLAIGNKEEHAILLCNFFLYFGKKALVLLGTSMLEGHVAYVVTQETNEYLLWNPS
TGQCYRQFDPFCPLKSVDCLFDDRNVWFNIQQNNTPMAVFFDYSKESFWKQLLPKNVQGT
KVQSIQPEEIMYFETDKSMVEDLRNRIERTLKSKVMEWRPKHPTHWNRQCTFILRQILPK
LEFGIGSFVSSEGDNEFERILQFYWVTGFPIQMPYTDVQSIIDAVYQTGIHSAEFPQTEF
ALAVYIHPYPNNILSVWVYLASLVPHQ
Download sequence
Identical sequences ENSPANP00000020705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]