SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020731 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000020731
Domain Number - Region: 138-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00753
Family FCH domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020731   Gene: ENSPANG00000021410   Transcript: ENSPANT00000012601
Sequence length 450
Comment pep:known_by_projection chromosome:PapAnu2.0:16:49478739:49491602:-1 gene:ENSPANG00000021410 transcript:ENSPANT00000012601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE
ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG
DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL
QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ
LELDDELKSVENQMRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK
Download sequence
Identical sequences A0A096P5V6 A0A0D9S1G3 A0A2K5NEA8 A0A2K5V263 A0A2K6ALF9 A0A2K6BSR7 A0A2K6LCG0 H9YW59
ENSPANP00000020731 ENSMMUP00000034399 NP_001253614.1.72884 XP_005584340.1.63531 XP_005584341.1.63531 XP_008010774.1.81039 XP_008010775.1.81039 XP_011723370.1.29376 XP_011723371.1.29376 XP_011854157.1.47321 XP_011854158.1.47321 XP_011902145.1.92194 XP_011902146.1.92194 XP_014975225.1.72884 XP_017723140.1.44346 XP_017723141.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]