SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020753 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020753
Domain Number 1 Region: 22-168
Classification Level Classification E-value
Superfamily EF-hand 6.32e-48
Family Calmodulin-like 0.000000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020753   Gene: ENSPANG00000021366   Transcript: ENSPANT00000013713
Sequence length 172
Comment pep:known_by_projection chromosome:PapAnu2.0:9:89062701:89066698:1 gene:ENSPANG00000021366 transcript:ENSPANT00000013713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFKKTNMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL
GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGK
ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Download sequence
Identical sequences A0A096P5X8 A0A2K6BZX5 F7HT47 G7PPK5
NP_001182743.1.72884 XP_007991209.1.81039 XP_011720239.1.29376 XP_011898210.1.92194 ENSPANP00000020753 9544.ENSMMUP00000027295 ENSMMUP00000015642 ENSMMUP00000027295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]