SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020756 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020756
Domain Number 1 Region: 552-1176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.75e-136
Family Tandem AAA-ATPase domain 0.052
Further Details:      
 
Domain Number 2 Region: 256-337
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000366
Family Cold shock DNA-binding domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020756   Gene: ENSPANG00000021364   Transcript: ENSPANT00000013716
Sequence length 1212
Comment pep:known_by_projection chromosome:PapAnu2.0:16:50071968:50113799:1 gene:ENSPANG00000021364 transcript:ENSPANT00000013716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVAMAGAIIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKVKQDPVVKPKTEKEKLKE
LFPVLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAVQEKQRDTEHRDRTKKKKRS
RNRERNRERDHRRRHRSRSRSRSRTRERNKAKSRYRSRSRSQSPPKDRKDRDKYGERNLD
RWRDKHVDRPPPEEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVA
NVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQESGEDLNPNRRRNLVGETNEETSMRNP
DRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILP
KVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERR
ELKQQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKA
SYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYT
SRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLR
ECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQY
FYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDT
ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTI
DGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAY
RDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALD
DEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALA
DQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDR
HKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEW
VVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEP
NAWRISRAFRRR
Download sequence
Identical sequences ENSPANP00000020756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]