SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020800 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020800
Domain Number 1 Region: 51-425
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.49e-47
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 550-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family EGF-type module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020800   Gene: ENSPANG00000021299   Transcript: ENSPANT00000014221
Sequence length 665
Comment pep:known_by_projection chromosome:PapAnu2.0:9:89629739:89794095:-1 gene:ENSPANG00000021299 transcript:ENSPANT00000014221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSADPGMSRMFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTD
VDHDGDFEIVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDI
DGDGREEIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVAC
VDRKGSGRYSIYIANYAYGNVGPDALIEMDPEASDLSQGILALRDVAAEAGVSKYTGGRG
VSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNR
DGKVDIVYGNWNGPHRLYLQMSAHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIF
FNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLIL
SHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSG
YLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEIPYPRDEDTLQNPAP
LECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCSRGYEPNEDG
TACVAQVAFLGTLGQSPGPRPTTPTAAAATATAAAAAGAATAAPVLVDGDLNLGSAVKEN
CEPSC
Download sequence
Identical sequences ENSPANP00000020800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]