SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020812 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020812
Domain Number 1 Region: 238-436
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.51e-48
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 453-529
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.6e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020812
Domain Number - Region: 684-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020812   Gene: ENSPANG00000021280   Transcript: ENSPANT00000014536
Sequence length 769
Comment pep:known_by_projection chromosome:PapAnu2.0:16:51340108:51365105:1 gene:ENSPANG00000021280 transcript:ENSPANT00000014536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLRRWAFAALLLPLLPPPGLGNQGSAGALRWGRLPQLGGPGAPEVTEPSRLVRESSGG
EVRKQQLDTRVRQEPPGGPPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFSRE
GTTQHSTGAGDHCYYQGKLRGNLHSFAALSTCQGLHGVFSDGNLTYIVEPQDMAGPWGAP
QGPLPHLIYRTPLLPDPLGCRELGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKY
VELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQ
VQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSRGGGVNEY
GNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSID
EYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLT
HDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQG
RCYGGRCKTRDRQCQALWGHAAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGF
LLCVNVSGAPRLGDLVGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNML
CLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPP
TGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA
Download sequence
Identical sequences ENSPANP00000020812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]