SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020837 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020837
Domain Number 1 Region: 591-601,647-1017
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.57e-98
Family Formin homology 2 domain (FH2 domain) 0.0000545
Further Details:      
 
Domain Number 2 Region: 35-169,230-451
Classification Level Classification E-value
Superfamily ARM repeat 4.55e-96
Family Diap1 N-terninal region-like 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020837
Domain Number - Region: 550-619
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000837
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020837   Gene: ENSPANG00000021231   Transcript: ENSPANT00000016183
Sequence length 1106
Comment pep:known_by_projection chromosome:PapAnu2.0:16:51795776:51820720:1 gene:ENSPANG00000021231 transcript:ENSPANT00000016183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAAGSTEQPAGPAAPPPKQPAPPKQPMPAAGELEERFNRALNCMNLPPDKVQLLSQYD
NEKKWELICDQERFQVKNPPAAYIQKLKSYVDTGGVSRKVAADWMSNLGFKRRVQESTQV
LRELETSLRTNHIGWVQEFLNEENRGLDVLLEYLAFAQCSVTYDMESTDNGASNSEKNKP
LEQSVEDLSKGPPSSVPKSRHLTIKCPPSPRLTPAHSRKALRNSRIVSQKDDVHVCIMCL
RAIMNYQSGFSLVMNHPACVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHDIILAAFD
NFKEVCGEQHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVENMNFRVFLQYEFTHLG
LDLYLERLRLTESDKLQVQIQAYLDNVFDVGALLEDTETKNAVLEHMEELQEQVALLTER
LRDAENESMAKIAELEKQLSQARKELETLRERFSESTAMGASRRPPEPEKAPPAAPTRPS
ALELKVEELEEKGLIRILRGPGDAVSIEILPVAVATPSGGDAPTPGVPTGSPSPDLAPAA
EPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP
PGTDGPVPPPPPPPGGPPDALGRRDSELGPGVKAKKPIQTKFRMPLLNWVALKPSQITGT
VFTELNDEKVLQELDMSDFEEQFKTKSQGPSLDLSTLKSKAAQKAPSKATLIEANRAKNL
AITLRKGNLGAERICQAIEAYDLQALGLDFLELLMRFLPTEYERSLIARFEREQRPMEEL
SEEDRFMLHFSRIPRLPERMTTLTFLGNFPDTAQLLMPQLNAIIAASMSIKSSDKLRQIL
EIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVIAEKYPQLTGFH
SDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCVVLKEFLRANSPTMDKLLA
DSKTAQEAFESVVEYFGENPKTTSPGLFFSLFSRFVKAYKKAEQEVEQWKKEAAAQEAGV
DTLGKGEPPAHKSPPKARRAQMDLISELKRKQQKEPLIYESDRDGAIEDIITDLRNQPYI
RADTGRRSARRRPPGPPLQVTSDLSL
Download sequence
Identical sequences A0A096P662
ENSPANP00000020837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]