SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020849 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020849
Domain Number 1 Region: 126-181
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000366
Family SNARE fusion complex 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020849
Domain Number - Region: 6-119
Classification Level Classification E-value
Superfamily t-snare proteins 0.000345
Family t-snare proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020849   Gene: ENSPANG00000021202   Transcript: ENSPANT00000016918
Sequence length 212
Comment pep:novel chromosome:PapAnu2.0:16:52352328:52369135:-1 gene:ENSPANG00000021202 transcript:ENSPANT00000016918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLYQQTHKQVHEIQSRMGRLETADKQSVQIVENEIQASIDQIFSRLERLEILSSKEPP
NKRQNAKLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPM
DESLQFNSSLQKVHHGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMR
LIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT
Download sequence
Identical sequences A0A0D9QUR8 A0A2K5XIT0 H9FMZ9
ENSPANP00000020849 NP_001244707.1.72884 XP_005584619.1.63531 XP_008010414.1.81039 XP_008010415.1.81039 XP_008010416.1.81039 XP_008010417.1.81039 XP_011716625.1.29376 XP_011857314.1.47321 XP_011915217.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]