SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020858 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020858
Domain Number 1 Region: 355-404,442-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000018
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 609-665
Classification Level Classification E-value
Superfamily EF-hand 0.0000908
Family Calmodulin-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020858   Gene: ENSPANG00000021208   Transcript: ENSPANT00000017722
Sequence length 804
Comment pep:known_by_projection chromosome:PapAnu2.0:9:92020466:92065333:-1 gene:ENSPANG00000021208 transcript:ENSPANT00000017722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVEIPEGQELQKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGPLQPQPKKPEDEPQET
AHRTQVSSCCLHICRGIRGLWGTTLTENTAENRELYVKTTLRELLVYIVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTASDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSL
GHGSHSFIYYENLLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPL
NGTAWTYHSQDELGGSSHWGRLTSYSGGGYYLDLPGSRQGSAEALQDLQEGLWLDRGTRV
VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRAVKLIRYVSNWDFFIVGCEVVFC
VFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSILAVGFHIFRTLEVNRLMGKLLQ
QPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKE
RVSDVQKVLQGGEQEIQFEDFTNTLREMGHAEHEITELTATFTKFDRDGNRILDEKEQEQ
MRQDLEGERVALNTEIEKLGRSIVSTPQGESGPEAAKAGGWVSGEEFYMLTRRVLQLETV
LEGVVSQVDAVGSKLKMLETKGWLVPSPGVEEQAIWKHLQPAPAVTPDPWGVQGGQESEV
PYKREEALEDRRCSSGEIPMLQRN
Download sequence
Identical sequences ENSPANP00000020858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]