SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020867 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020867
Domain Number 1 Region: 133-380
Classification Level Classification E-value
Superfamily vWA-like 4.45e-86
Family Integrin A (or I) domain 0.000000000301
Further Details:      
 
Domain Number 2 Region: 376-466
Classification Level Classification E-value
Superfamily Integrin domains 1.62e-33
Family Integrin domains 0.0000031
Further Details:      
 
Domain Number 3 Region: 632-716
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.15e-24
Family Integrin beta tail domain 0.0000037
Further Details:      
 
Domain Number 4 Region: 29-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000942
Family Plexin repeat 0.0000277
Further Details:      
 
Domain Number 5 Region: 590-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 6 Region: 548-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020867
Domain Number - Region: 516-548
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0262
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020867   Gene: ENSPANG00000021164   Transcript: ENSPANT00000018118
Sequence length 788
Comment pep:novel chromosome:PapAnu2.0:16:53648322:53704106:1 gene:ENSPANG00000021164 transcript:ENSPANT00000018118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQPGPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLSLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSRHCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT
Download sequence
Identical sequences A0A2I3MIT0 A0A2K5LTD1 A0A2K5YHH7 A0A2K6BAZ5 G7NJ66 G7PV32
ENSPANP00000020867 XP_005584667.1.63531 XP_011741948.1.29376 XP_011828658.1.47321 XP_011925922.1.92194 XP_014974842.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]