SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020875 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020875
Domain Number 1 Region: 607-736
Classification Level Classification E-value
Superfamily EF-hand 3.55e-16
Family Calmodulin-like 0.0075
Further Details:      
 
Domain Number 2 Region: 455-593
Classification Level Classification E-value
Superfamily EF-hand 4.45e-16
Family Calmodulin-like 0.014
Further Details:      
 
Domain Number 3 Region: 759-895
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000246
Family Calmodulin-like 0.0037
Further Details:      
 
Domain Number 4 Region: 168-284
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000178
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020875   Gene: ENSPANG00000021131   Transcript: ENSPANT00000022516
Sequence length 975
Comment pep:known_by_projection chromosome:PapAnu2.0:16:53717271:53843534:1 gene:ENSPANG00000021131 transcript:ENSPANT00000022516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METNIHFFCQAEENIDFLDDGSNSFATGLPSGTINHKKYIKFSKTIEKKISPEVRSLSPE
YKKIFETSVFLCGEEKSSDFSVGKKGGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENS
LCKLPNQYSLHKTSSPLCTSSAITREKEMLSNLYMTLYDEVTHGYLYSQELSALHKACKI
FSKIRSGKIYVNDLPVILGILRISISDLEMRQALKTIDIDAFWDALKIFCRIKGGRVSTD
EIFGVLDSMGIPINPEILEEVIKHTYIDSNHMVDIGDIIFILNELQEQYEDVPITEESPL
DEITSDRKLSSIAGCYLKYKKKNSLSSKLPEPSISKKLNNKSNQYYSKIMENDDLESKRS
KNTWQIRKFLDGVSSSNVGVQEPYSKNGINFKKHSEKGEIHDSKSKPQSLKSSTSLSKSL
DKSDISSIPKLQKPTVRKRSSLLKQVSSTEKTAINTLENFCEAISKLQENYISAEGLQSI
LPSVGITLLDKEFQKIVTDTSRNETENGMVELDDFISTLANEQSFPECNALPGVIKAIDK
IKDKNVDYEDLNTCLQNFGIYLSKPEFKKITELTEAGETKKVNFKEFIDTMMSNTECLSE
KLLLPDAIETLDNLRKETMSVSDLWNILSSLNSNLKKDEFLAALKLVTVDEGDKVQFEEF
AQVVRNMRDAARLEELQEVVLAADLLEGDMIAEENLEDFLRNIGIKSPKEEVEKILQSDF
VSEDNMVNIKDCMRALRDTQKFSNYIDFRKEASNLKLPKVNEIKEVANILSHVDNGKIGV
PDLEHALKCLNVNLTEEDFDGALNCCNVSDNMEVDLKDFLIKMKESPHFQKSKATQILLA
ATQILQNDLIDVSDLKTLLMDKDLHTANAILTVMLRHVPEHESGKVTIQEFMTKFSDILT
IPKPAGKFYLICNYCPDLERQAVVYMLKTIQDSIVKAQVSKKQYNMNMKQHKSRLHNFCL
NSKANIAKLNPNSKF
Download sequence
Identical sequences ENSPANP00000020875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]