SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020879 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020879
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020879   Gene: ENSPANG00000021122   Transcript: ENSPANT00000012979
Sequence length 159
Comment pep:known_by_projection chromosome:PapAnu2.0:9:92723763:92724579:-1 gene:ENSPANG00000021122 transcript:ENSPANT00000012979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGSVREESIHCKSVEEISTLVQKLANQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRELCPREVQDPAPAQVQAQ
Download sequence
Identical sequences H9EVY0
ENSPANP00000020879 XP_005566284.1.63531 XP_011733915.1.29376 XP_011832806.1.47321 XP_011832807.1.47321 XP_011906919.1.92194 XP_015003518.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]