SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020919 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020919
Domain Number 1 Region: 67-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000421
Family LIM domain 0.00074
Further Details:      
 
Domain Number 2 Region: 33-65
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000048
Family LIM domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020919   Gene: ENSPANG00000021021   Transcript: ENSPANT00000022500
Sequence length 127
Comment pep:known_by_projection chromosome:PapAnu2.0:16:55549254:55549993:-1 gene:ENSPANG00000021021 transcript:ENSPANT00000022500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQAAGAAQATPSHDAKGGGGSTVQRSKSFSLRAQVKETCAACQKTVYPMERLVADKLIF
HNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWAHKEV
DPGTKTA
Download sequence
Identical sequences A0A096P6E4
ENSPANP00000020919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]