SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020930 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020930
Domain Number 1 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 9.42e-19
Family RING finger domain, C3HC4 0.0073
Further Details:      
 
Domain Number 2 Region: 138-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000763
Family B-box zinc-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020930
Domain Number - Region: 181-270
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0105
Family Arfaptin, Rac-binding fragment 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020930   Gene: ENSPANG00000020989   Transcript: ENSPANT00000028949
Sequence length 551
Comment pep:known_by_projection chromosome:PapAnu2.0:9:94436617:94449734:1 gene:ENSPANG00000020989 transcript:ENSPANT00000028949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYN
QKPGLEKNLKLTNIVEKFNALHVEKPPAALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQ
THLQQPSTARGHLLVEADDVRAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVC
DVEIRRNEIRKMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEKVSQLKEEVRLQYEKLH
QLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGSLQLLFDKTEDVSFMK
NTKSVKILMDRTQTCTGSSLSPPKIGHLNSKLFLNEVAKKEKQLRKMLEGPFSTPVPFLQ
SVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGEGQSGQPLGPCS
STQHLVALPGGAQPVHSSPVFPPSQYPNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVAN
HGGHQPYPRSGHFPWTVPSQEYSHPLPPTPSVPQSLPSLAVRDWLDASQQPGHQDFYRVY
GQPSTKHYVTS
Download sequence
Identical sequences A0A096P6F5 A0A0D9QZD2 A0A2K5M410 A0A2K5WS65 A0A2K5ZUR1 A0A2K6D435 F7FM93
ENSPANP00000020930 ENSMMUP00000005872 NP_001253657.1.72884 XP_005566373.1.63531 XP_007962173.1.81039 XP_011733810.1.29376 XP_011832869.1.47321 XP_011907064.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]