SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020946 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020946
Domain Number 1 Region: 1572-1865
Classification Level Classification E-value
Superfamily TPR-like 5.31e-47
Family HAT/Suf repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 168-281
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.31e-18
Family Cold shock DNA-binding domain-like 0.00000259
Further Details:      
 
Domain Number 3 Region: 440-529
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.58e-18
Family Cold shock DNA-binding domain-like 0.0051
Further Details:      
 
Domain Number 4 Region: 719-802
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.19e-17
Family Cold shock DNA-binding domain-like 0.0026
Further Details:      
 
Domain Number 5 Region: 533-617
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.34e-17
Family Cold shock DNA-binding domain-like 0.0033
Further Details:      
 
Domain Number 6 Region: 1310-1398
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000895
Family Cold shock DNA-binding domain-like 0.0086
Further Details:      
 
Domain Number 7 Region: 1029-1105
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000164
Family Cold shock DNA-binding domain-like 0.017
Further Details:      
 
Domain Number 8 Region: 1222-1315
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000281
Family Cold shock DNA-binding domain-like 0.019
Further Details:      
 
Domain Number 9 Region: 267-353
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000756
Family Cold shock DNA-binding domain-like 0.019
Further Details:      
 
Domain Number 10 Region: 73-174
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000433
Family Cold shock DNA-binding domain-like 0.022
Further Details:      
 
Domain Number 11 Region: 1136-1221
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000493
Family Cold shock DNA-binding domain-like 0.037
Further Details:      
 
Domain Number 12 Region: 631-707
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000577
Family Cold shock DNA-binding domain-like 0.05
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020946
Domain Number - Region: 379-441
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000583
Family Single strand DNA-binding domain, SSB 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020946   Gene: ENSPANG00000020959   Transcript: ENSPANT00000012232
Sequence length 1872
Comment pep:known_by_projection chromosome:PapAnu2.0:9:95221482:95275392:1 gene:ENSPANG00000020959 transcript:ENSPANT00000012232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALEESFPRGGTRKIHKPEKAFQQSVEQDNLFDISTEEGSTKRKKSQKGPAKTKKLKIE
KRESSKSAREKFEILSVESLCEGMRILGCVKEVNELELVISLPNGLQGFVQVTEICDAYT
KKLNEQVTQEQPLKDLLHLPELFSPGMLVRCVVSSLGITDRGKKSVKLSLNPKNVNRVLS
AEALKPGMLLTGTVSSLEDHGYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAKLKVGQYLN
CIVEKVKGNGGVVSLSVGHSEVSTAIATEEQSWTLNNLLPGLVVKAQVQKVTPFGLTLNF
LTFFTGMVDFMHLDPKKAGTYFSNQAVRACILCVHPRTRVVRLSLRPIFLQPGRPLTRLS
CQNLGTVLDDVPVQGFFKKAGATFRLKDGVLAYARLNHLSDSKNVFNPEAFKPGNTHKCR
IIDYSQMDELALLSLRTSIIEAQYLRYHDIEPGAVVKGIVLTIKSYGMLVKVGEQMRGLV
PPMHLADILMKNPEKKYHIGDEVKCRVLLCDPEAKKLMMTLKKTLVESKLPVITCYADAK
PGLQTHGFIIRVKDYGCIVKFYNNVQGLVPKHELSTEYIPDPERVFYTGQVVKVAVLNCE
PSKERMLLSFKLSSDPEPKKEPAGHSQKKGKAINIGQLVDVKVLEKTKDGLEVAVLPHNI
RAFLPTSHLSDHVANGPLLHHWLQAGDILHRVLCLSQSEGHVLLCRKPALVSTVEGGQDP
KNFSEIHPGMLLIGFVKSIKDYGVFIQFPSGLSGLAPKAIMSDKFVTSTSDHFVEGQTVA
AKVTNVDEEKQRMLLSLRLSDCALGDLATTSLLLLSQCLEELQGVRSLMSNRDSVLIQTL
AEMTPGMFLDLVVQEVLEDGSVVFSGGPVPDLVLRASRYHRAGQEVESGQKKKVVILNVD
LLKLEVHVSLHQDLVNRKAKKLRKGSEHQAIVQHLEKSFAIASLVETGHLAAFSLTSHLN
DTFRFDSEKLQVGQGVSLTLKTTEPGVTGLLLAVEGPAAKRTMRPTRKDSETVDEDEEVD
PALTVGTVKKHTLSIGDMVTGTVKSIKPTHVVVTLEDGIIGCIHASHILDDVPEGISPTT
KLKVGKTVTARVIGGRDMKTFKFLPISHPRFVRTIPELSVRPSELEDGHTALNTHSVSPV
EKIKQYQAGQTVTCFLKKYNVVKKWLEVEIAPDIRGRIPLLLTSLSFKVLKHPDKKFRVG
QALRATVVGPDSSKAFLCLSLIGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSI
FHVSDSYSETPLEDFVPQKVVRCYILSTADSVLTLSLRSSRTNPETKSKVEDPEINSIQD
IKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTAR
VLRLNHQKNLVELSFLPGDTGKPDLLSASLEGPLPKQEERKTEAEERDQKGEKKNQKRNE
KKNQKGQEEVELPSKEKQQPQKPQAQKRGGRERRESGSEQERVSKKPKKASPSEEDDSLM
DVYYREGKEEAEETNVLRKEKQTKPAEVPRLQLSSGFAWNVGLDSLAPALPPLAESSDSE
EDEKPHQATQKKKSKKERELEKQKAEKELSRIEEALMDPGRQPESADDFDRLVLSSPNSS
ILWLQYMAFHLQATEIEKARAVAERALKTISFREEQEKLNVWVALLNLENMYGSQESLTK
VFERAVQYNEPLKVFLHLADIYAKSEKFQEAGELYNRMLKRFRQEKAVWIKYGAFLLRRS
QAEASHRVLQRALECLPSKEHVDVIAKFAQLEFQLGDAERAKAIFENTLSTYPKRTDVWS
VYIDMTIKHGSQKAVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKAL
EYVEAKSSVLED
Download sequence
Identical sequences ENSPANP00000020946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]