SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020953 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020953
Domain Number 1 Region: 189-307
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.7e-47
Family An Obfc1 domain 0.000048
Further Details:      
 
Domain Number 2 Region: 34-172
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-21
Family Single strand DNA-binding domain, SSB 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020953   Gene: ENSPANG00000020926   Transcript: ENSPANT00000026475
Sequence length 368
Comment pep:known_by_projection chromosome:PapAnu2.0:9:95716560:95752331:-1 gene:ENSPANG00000020926 transcript:ENSPANT00000026475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNRHPIKQVDVL
GTVVGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETI
ERRTKIEIGDTIRVRGSIRTYREEREIHATAYYKVDDPVWNIQIARMLELPTIYRKVYDQ
PFRSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLCLAN
QPVIHSACSDQVNFKKDTTSKAIHSIFKNAIQLLREKGLVFQKDDGFDNLYYVTREDKDL
HRKIHQIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVST
MEHYYTAF
Download sequence
Identical sequences A0A096P6H8
ENSPANP00000020953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]